Lineage for d2nvye2 (2nvy E:144-215)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913988Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 1913989Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 1913990Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 1913991Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 1913992Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1914006Domain d2nvye2: 2nvy E:144-215 [138685]
    Other proteins in same PDB: d2nvya1, d2nvyb1, d2nvyc1, d2nvyc2, d2nvye1, d2nvyf1, d2nvyh1, d2nvyi1, d2nvyi2, d2nvyj1, d2nvyk1, d2nvyl1
    automatically matched to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d2nvye2

PDB Entry: 2nvy (more details), 3.4 Å

PDB Description: RNA Polymerase II form II in 150 mM Mn+2
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2nvye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvye2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2nvye2:

Click to download the PDB-style file with coordinates for d2nvye2.
(The format of our PDB-style files is described here.)

Timeline for d2nvye2: