| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
| Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
| Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries) Uniprot P20434; part of multichain biological unit |
| Domain d2nvye1: 2nvy E:2-143 [138684] Other proteins in same PDB: d2nvya1, d2nvyb1, d2nvyc1, d2nvyc2, d2nvye2, d2nvyf1, d2nvyh1, d2nvyi1, d2nvyi2, d2nvyj1, d2nvyk1, d2nvyl1 automatically matched to d1i3qe1 protein/DNA complex; protein/RNA complex; complexed with mn, zn |
PDB Entry: 2nvy (more details), 3.4 Å
SCOPe Domain Sequences for d2nvye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvye1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn
Timeline for d2nvye1: