Lineage for d2nvyb1 (2nvy B:20-1224)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249907Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 2249908Protein RBP2 [64491] (2 species)
  7. 2249909Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 2249921Domain d2nvyb1: 2nvy B:20-1224 [138681]
    Other proteins in same PDB: d2nvya1, d2nvyc1, d2nvyc2, d2nvye1, d2nvye2, d2nvyf1, d2nvyh1, d2nvyi1, d2nvyi2, d2nvyj1, d2nvyk1, d2nvyl1
    automatically matched to d1i50b_
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d2nvyb1

PDB Entry: 2nvy (more details), 3.4 Å

PDB Description: RNA Polymerase II form II in 150 mM Mn+2
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOPe Domain Sequences for d2nvyb1:

Sequence, based on SEQRES records: (download)

>d2nvyb1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d2nvyb1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgkiyv
tkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyekvfigrlpimlrskncyls
eatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirs
alekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehic
ydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflp
hitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfk
kltkdifrymqrtvelainaktitsglkyalatgnwgagvsqvlnrytysstlshlrrtn
tpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmep
ledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelk
iftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyid
aeeeesiliamqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdhnq
sprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqna
ivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntl
rmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvtt
nqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinpha
ipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmyngh
tgkklmaqiffgptyyqrlrhmvddkiharargpglrfgemerdcmiahgaasflkerlm
easdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamni
tprlytdrsrdf

SCOPe Domain Coordinates for d2nvyb1:

Click to download the PDB-style file with coordinates for d2nvyb1.
(The format of our PDB-style files is described here.)

Timeline for d2nvyb1: