![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) ![]() automatically mapped to Pfam PF01194 |
![]() | Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
![]() | Protein RNA polymerase subunit RPB10 [46926] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries) Uniprot P22139; part of multichain biological unit |
![]() | Domain d2nvxj1: 2nvx J:1-65 [138677] Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxk1, d2nvxl1 automatically matched to d1i3qj_ protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn |
PDB Entry: 2nvx (more details), 3.6 Å
SCOPe Domain Sequences for d2nvxj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvxj1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d2nvxj1: