Lineage for d2nvxj1 (2nvx J:1-65)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1081028Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 1081029Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1081030Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 1081031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (27 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1081051Domain d2nvxj1: 2nvx J:1-65 [138677]
    Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxk1, d2nvxl1
    automatically matched to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxj1

PDB Entry: 2nvx (more details), 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2nvxj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvxj1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d2nvxj1:

Click to download the PDB-style file with coordinates for d2nvxj1.
(The format of our PDB-style files is described here.)

Timeline for d2nvxj1: