![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
![]() | Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) |
![]() | Domain d2nvxi1: 2nvx I:2-49 [138675] Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxj1, d2nvxk1, d2nvxl1 automatically matched to d1i3qi1 complexed with dut, mg, zn |
PDB Entry: 2nvx (more details), 3.6 Å
SCOP Domain Sequences for d2nvxi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvxi1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d2nvxi1: