Lineage for d2nvxe2 (2nvx E:144-215)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865615Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 865616Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 865617Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 865618Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 865619Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 865637Domain d2nvxe2: 2nvx E:144-215 [138672]
    Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxf1, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
    automatically matched to d1dzfa2
    complexed with dut, mg, zn

Details for d2nvxe2

PDB Entry: 2nvx (more details), 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2nvxe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvxe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d2nvxe2:

Click to download the PDB-style file with coordinates for d2nvxe2.
(The format of our PDB-style files is described here.)

Timeline for d2nvxe2: