SCOPe 2.01: Domain d2nvxe1: 2nvx E:2-143

Lineage for d2nvxe1 (2nvx E:2-143)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2nvxe1: 2nvx E:2-143 [138671]
   Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
   automatically matched to d1i3qe1
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxe1

PDB Entry: 2nvx, 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2nvxe1:

Sequence; same for both SEQRES and ATOM records:

>d2nvxe1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d2nvxe1:

• d2nvxe1 first appeared in SCOP 1.73
  
• d2nvxe1 appears in SCOP 1.75
  
• d2nvxe1 appears in SCOPe 2.02
  
• d2nvxe1 appears in the current release, SCOPe 2.08