Lineage for d2nvxc2 (2nvx C:42-172)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1227977Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1227978Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 1227979Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1228032Protein RPB3 [64462] (1 species)
  7. 1228033Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1228050Domain d2nvxc2: 2nvx C:42-172 [138670]
    Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
    automatically matched to d1i3qc2
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxc2

PDB Entry: 2nvx (more details), 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2nvxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvxc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d2nvxc2:

Click to download the PDB-style file with coordinates for d2nvxc2.
(The format of our PDB-style files is described here.)

Timeline for d2nvxc2: