Lineage for d2nvxb1 (2nvx B:20-1222)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954356Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1954357Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1954358Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1954359Protein RBP2 [64491] (2 species)
  7. 1954360Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 1954380Domain d2nvxb1: 2nvx B:20-1222 [138668]
    Other proteins in same PDB: d2nvxa1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
    automatically matched to d1i50b_
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxb1

PDB Entry: 2nvx (more details), 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOPe Domain Sequences for d2nvxb1:

Sequence, based on SEQRES records: (download)

>d2nvxb1 e.29.1.1 (B:20-1222) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsr

Sequence, based on observed residues (ATOM records): (download)

>d2nvxb1 e.29.1.1 (B:20-1222) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliyeisfgkiy
vtkpmvnesdgvthalypqearlrnltyssglfvdvkkkvfigrlpimlrskncylseat
esdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsale
kgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydv
ndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphit
qlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkklt
kdifrymqrtvelainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstls
hlrrtntpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeeytwssllne
glveyidaeeeesiliamqpedlepaedvdpakrirvshhattfthceihpsmilgvaas
iipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkf
relpagqnaivaiacysgynqedsmimnqssidrglfrslffrsymdqekksitetfekp
qrtntlrmkhgtydkldddgliapgvrvsgedviigkttpispdskrdastplrstengi
vdqvlvttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivp
dliinphaipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrg
fevmynghtgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdggl
rfgemerdcmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnk
idiyqihipyaakllfqelmamnitprlytdrsr

SCOPe Domain Coordinates for d2nvxb1:

Click to download the PDB-style file with coordinates for d2nvxb1.
(The format of our PDB-style files is described here.)

Timeline for d2nvxb1: