Lineage for d2nvwa1 (2nvw A:-11-154,A:374-457)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2092282Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 protein domains)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2092455Protein Galactose/lactose metabolism regulatory protein GAL80 [141921] (1 species)
  7. 2092456Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [141922] (2 PDB entries)
    Uniprot Q06433 2-154,374-457
  8. 2092457Domain d2nvwa1: 2nvw A:-11-154,A:374-457 [138665]
    Other proteins in same PDB: d2nvwa2, d2nvwa3

Details for d2nvwa1

PDB Entry: 2nvw (more details), 2.1 Å

PDB Description: Crystal sctucture of transcriptional regulator Gal80p from kluyveromymes lactis
PDB Compounds: (A:) Galactose/lactose metabolism regulatory protein GAL80

SCOPe Domain Sequences for d2nvwa1:

Sequence, based on SEQRES records: (download)

>d2nvwa1 c.2.1.3 (A:-11-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
ssenlyfqghmlannnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfq
ivalynptlksslqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknile
hssqnlnlrylyvewalaasvqqaeelysisqqranlqtiiclqgrXynsvvgnilriye
siadyhflgkpeskssrgpddlfastkfdkqgfrfegfptfkdaiilhrlidavfrsdke
ektldvskimi

Sequence, based on observed residues (ATOM records): (download)

>d2nvwa1 c.2.1.3 (A:-11-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
ssenlyfqghmlannnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlssqfq
ivalynptlksslqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvknile
hssqnlnlrylyvewalaasvqqaeelysisqqranlqtiiclqgrXynsvvgnilriye
siadyhflkfdkqgfrfegfptfkdaiilhrlidavfrsdkeektldvskimi

SCOPe Domain Coordinates for d2nvwa1:

Click to download the PDB-style file with coordinates for d2nvwa1.
(The format of our PDB-style files is described here.)

Timeline for d2nvwa1: