Lineage for d2nvuj1 (2nvu J:1-76)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717136Protein Nedd8 [54244] (1 species)
  7. 717137Species Human (Homo sapiens) [TaxId:9606] [54245] (6 PDB entries)
  8. 717145Domain d2nvuj1: 2nvu J:1-76 [138664]
    Other proteins in same PDB: d2nvua1, d2nvub1, d2nvub2
    automatically matched to d1nddb_
    complexed with atp, mg, zn; mutant

Details for d2nvuj1

PDB Entry: 2nvu (more details), 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
PDB Compounds: (J:) nedd8

SCOP Domain Sequences for d2nvuj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvuj1 d.15.1.1 (J:1-76) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOP Domain Coordinates for d2nvuj1:

Click to download the PDB-style file with coordinates for d2nvuj1.
(The format of our PDB-style files is described here.)

Timeline for d2nvuj1: