Lineage for d2nvui1 (2nvu I:1-76)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853598Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 853654Protein Nedd8 [54244] (1 species)
  7. 853655Species Human (Homo sapiens) [TaxId:9606] [54245] (6 PDB entries)
    Uniprot Q15843
  8. 853662Domain d2nvui1: 2nvu I:1-76 [138663]
    Other proteins in same PDB: d2nvua1, d2nvub1, d2nvub2, d2nvuc1
    automatically matched to d1nddb_
    complexed with atp, mg, zn; mutant

Details for d2nvui1

PDB Entry: 2nvu (more details), 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
PDB Compounds: (I:) nedd8

SCOP Domain Sequences for d2nvui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvui1 d.15.1.1 (I:1-76) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOP Domain Coordinates for d2nvui1:

Click to download the PDB-style file with coordinates for d2nvui1.
(The format of our PDB-style files is described here.)

Timeline for d2nvui1: