![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (7 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein Nedd8 [54244] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54245] (6 PDB entries) |
![]() | Domain d2nvui1: 2nvu I:1-76 [138663] Other proteins in same PDB: d2nvua1, d2nvub1, d2nvub2 automatically matched to d1nddb_ complexed with atp, mg, zn; mutant |
PDB Entry: 2nvu (more details), 2.8 Å
SCOP Domain Sequences for d2nvui1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvui1 d.15.1.1 (I:1-76) Nedd8 {Human (Homo sapiens) [TaxId: 9606]} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlalrgg
Timeline for d2nvui1:
![]() Domains from other chains: (mouse over for more information) d2nvua1, d2nvub1, d2nvub2, d2nvuj1 |