Lineage for d2nvub2 (2nvu B:1002-1367)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710663Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 710674Species Escherichia coli [TaxId:562] [53863] (45 PDB entries)
  8. 710712Domain d2nvub2: 2nvu B:1002-1367 [138662]
    Other proteins in same PDB: d2nvua1, d2nvub1, d2nvui1, d2nvuj1
    automatically matched to d1mh3a2
    complexed with atp, mg, zn; mutant

Details for d2nvub2

PDB Entry: 2nvu (more details), 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
PDB Compounds: (B:) Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera

SCOP Domain Sequences for d2nvub2:

Sequence, based on SEQRES records: (download)

>d2nvub2 c.94.1.1 (B:1002-1367) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqt

Sequence, based on observed residues (ATOM records): (download)

>d2nvub2 c.94.1.1 (B:1002-1367) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkval
ksyeeeatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaalaaaqt

SCOP Domain Coordinates for d2nvub2:

Click to download the PDB-style file with coordinates for d2nvub2.
(The format of our PDB-style files is described here.)

Timeline for d2nvub2: