Lineage for d2nvub2 (2nvu B:1002-1367)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144348Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2144366Species Escherichia coli [TaxId:562] [53863] (65 PDB entries)
    Uniprot P02928
  8. 2144420Domain d2nvub2: 2nvu B:1002-1367 [138662]
    Other proteins in same PDB: d2nvua_, d2nvub1, d2nvuc1, d2nvui_, d2nvuj_
    automatically matched to d1mh3a2
    complexed with atp, mg, zn

Details for d2nvub2

PDB Entry: 2nvu (more details), 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
PDB Compounds: (B:) Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera

SCOPe Domain Sequences for d2nvub2:

Sequence, based on SEQRES records: (download)

>d2nvub2 c.94.1.1 (B:1002-1367) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqt

Sequence, based on observed residues (ATOM records): (download)

>d2nvub2 c.94.1.1 (B:1002-1367) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkval
ksyeeeatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaalaaaqt

SCOPe Domain Coordinates for d2nvub2:

Click to download the PDB-style file with coordinates for d2nvub2.
(The format of our PDB-style files is described here.)

Timeline for d2nvub2: