| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) ![]() transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
| Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins) the common fold is elaborated with additional (sub)domains |
| Protein UBA3 [89764] (1 species) a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered) |
| Species Human (Homo sapiens) [TaxId:9606] [89765] (12 PDB entries) Uniprot Q8TBC4 33-458 |
| Domain d2nvub1: 2nvu B:2012-2441 [138661] Other proteins in same PDB: d2nvua_, d2nvub2, d2nvuc1, d2nvui_, d2nvuj_ automatically matched to d1ngvb_ complexed with atp, mg, zn |
PDB Entry: 2nvu (more details), 2.8 Å
SCOPe Domain Sequences for d2nvub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvub1 c.111.1.2 (B:2012-2441) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfklhft
Timeline for d2nvub1:
View in 3DDomains from other chains: (mouse over for more information) d2nvua_, d2nvuc1, d2nvui_, d2nvuj_ |