SCOP 1.73: Domain d2nvua1: 2nvu A:6-534

Lineage for d2nvua1 (2nvu A:6-534)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest

4. Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families)
   transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
   the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds

5. Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
   the common fold is elaborated with additional (sub)domains

6. Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
   a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion

7. Species Human (Homo sapiens) [TaxId:9606] [89767] (5 PDB entries)

8. Domain d2nvua1: 2nvu A:6-534 [138660]
   Other proteins in same PDB: d2nvub1, d2nvub2, d2nvui1, d2nvuj1
   automatically matched to d1ngva_
   complexed with atp, mg, zn; mutant

Details for d2nvua1

PDB Entry: 2nvu, 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex

PDB Compounds: (A:) NEDD8-activating enzyme E1 regulatory subunit

SCOP Domain Sequences for d2nvua1:

Sequence; same for both SEQRES and ATOM records:

>d2nvua1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
lirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

Timeline for d2nvua1:

• d2nvua1 is new in SCOP 1.73
  
• d2nvua1 appears in SCOP 1.75
  
• d2nvua1 appears in the current release, SCOPe 2.08, called d2nvua_