| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) ![]() transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
| Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 proteins) the common fold is elaborated with additional (sub)domains |
| Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species) a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion |
| Species Human (Homo sapiens) [TaxId:9606] [89767] (10 PDB entries) Uniprot Q13564 |
| Domain d2nvua_: 2nvu A: [138660] Other proteins in same PDB: d2nvub1, d2nvub2, d2nvuc1, d2nvui_, d2nvuj_ automated match to d1tt5a_ complexed with atp, mg, zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 2nvu (more details), 2.8 Å
SCOPe Domain Sequences for d2nvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvua_ c.111.1.2 (A:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
gkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnq
vsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrft
vvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlr
ldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfr
dlirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsf
wilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakl
lqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneiv
lylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcr
ygaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
Timeline for d2nvua_: