Lineage for d2nvtk1 (2nvt K:1-114)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200525Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2200656Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2200759Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 2200766Protein RPB11 [64312] (2 species)
  7. 2200767Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 2200779Domain d2nvtk1: 2nvt K:1-114 [138658]
    Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte1, d2nvte2, d2nvtf1, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtl1
    automatically matched to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2nvtk1

PDB Entry: 2nvt (more details), 3.36 Å

PDB Description: RNA Polymerase II Elongation Complex in 150 mM Mg+2 with GMPCPP
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d2nvtk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvtk1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2nvtk1:

Click to download the PDB-style file with coordinates for d2nvtk1.
(The format of our PDB-style files is described here.)

Timeline for d2nvtk1: