![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.2: RBP11/RpoL [64311] (3 proteins) |
![]() | Protein RPB11 [64312] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries) Uniprot P38902; part of multichain biological unit |
![]() | Domain d2nvtk1: 2nvt K:1-114 [138658] Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte1, d2nvte2, d2nvtf1, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtl1 automatically matched to d1i3qk_ protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn |
PDB Entry: 2nvt (more details), 3.36 Å
SCOPe Domain Sequences for d2nvtk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvtk1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d2nvtk1: