![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) ![]() automatically mapped to Pfam PF01191 |
![]() | Family d.78.1.1: RPB5 [55288] (2 proteins) |
![]() | Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries) Uniprot P20434; part of multichain biological unit |
![]() | Domain d2nvte2: 2nvt E:144-215 [138652] Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte1, d2nvtf1, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtk1, d2nvtl1 automatically matched to d1dzfa2 protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn |
PDB Entry: 2nvt (more details), 3.36 Å
SCOPe Domain Sequences for d2nvte2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvte2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d2nvte2: