Lineage for d2nvtb1 (2nvt B:20-1224)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694801Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1694802Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1694803Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1694804Protein RBP2 [64491] (2 species)
  7. 1694805Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 1694819Domain d2nvtb1: 2nvt B:20-1224 [138648]
    Other proteins in same PDB: d2nvta1, d2nvtc1, d2nvtc2, d2nvte1, d2nvte2, d2nvtf1, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtk1, d2nvtl1
    automatically matched to d1i50b_
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2nvtb1

PDB Entry: 2nvt (more details), 3.36 Å

PDB Description: RNA Polymerase II Elongation Complex in 150 mM Mg+2 with GMPCPP
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOPe Domain Sequences for d2nvtb1:

Sequence, based on SEQRES records: (download)

>d2nvtb1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d2nvtb1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgkiyv
tkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyeaidkvfigrlpimlrsknc
ylseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvae
irsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeile
hicydvndwqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqle
gfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdi
frymqrtvelainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlr
rtntpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewg
mepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirek
elkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglve
yidaeeeesiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiip
fpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrel
pagqnaivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekp
qrtntlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivd
qvlvttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdl
iinphaipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfe
vmynghtgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrf
gemerdcmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkid
iyqihipyaakllfqelmamnitprlytdrsrdf

SCOPe Domain Coordinates for d2nvtb1:

Click to download the PDB-style file with coordinates for d2nvtb1.
(The format of our PDB-style files is described here.)

Timeline for d2nvtb1: