Lineage for d2nvqk_ (2nvq K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564986Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2565024Protein automated matches [190337] (2 species)
    not a true protein
  7. 2565025Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (5 PDB entries)
  8. 2565028Domain d2nvqk_: 2nvq K: [138645]
    Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf_, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvql_
    automated match to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqk_

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d2nvqk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2nvqk_:

Click to download the PDB-style file with coordinates for d2nvqk_.
(The format of our PDB-style files is described here.)

Timeline for d2nvqk_: