Lineage for d2nvqk1 (2nvq K:1-114)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726910Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 726990Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 727071Family d.74.3.2: RBP11/RpoL [64311] (2 proteins)
  6. 727078Protein RPB11 [64312] (1 species)
  7. 727079Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (24 PDB entries)
  8. 727084Domain d2nvqk1: 2nvq K:1-114 [138645]
    Other proteins in same PDB: d2nvqa1, d2nvqb1, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf1, d2nvqh1, d2nvqi1, d2nvqi2, d2nvqj1, d2nvql1
    automatically matched to d1i3qk_
    complexed with dut, mg, zn

Details for d2nvqk1

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOP Domain Sequences for d2nvqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqk1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d2nvqk1:

Click to download the PDB-style file with coordinates for d2nvqk1.
(The format of our PDB-style files is described here.)

Timeline for d2nvqk1: