Lineage for d2nvqj_ (2nvq J:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260703Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1260704Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1260741Protein automated matches [190336] (1 species)
    not a true protein
  7. 1260742Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187159] (2 PDB entries)
  8. 1260744Domain d2nvqj_: 2nvq J: [138644]
    Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf_, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqk_, d2nvql_
    automated match to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqj_

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2nvqj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqj_ a.4.11.1 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d2nvqj_:

Click to download the PDB-style file with coordinates for d2nvqj_.
(The format of our PDB-style files is described here.)

Timeline for d2nvqj_: