Lineage for d2nvqi1 (2nvq I:2-49)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641064Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 2641065Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 2641066Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 2641067Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 2641084Domain d2nvqi1: 2nvq I:2-49 [138642]
    Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf_, d2nvqh_, d2nvqj_, d2nvqk_, d2nvql_
    automated match to d1twfi1
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqi1

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2nvqi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqi1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOPe Domain Coordinates for d2nvqi1:

Click to download the PDB-style file with coordinates for d2nvqi1.
(The format of our PDB-style files is described here.)

Timeline for d2nvqi1: