Lineage for d2nvqh1 (2nvq H:2-146)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 800248Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
  6. 800249Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 800250Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (30 PDB entries)
    Uniprot P20436
  8. 800257Domain d2nvqh1: 2nvq H:2-146 [138641]
    Other proteins in same PDB: d2nvqa1, d2nvqb1, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf1, d2nvqi1, d2nvqi2, d2nvqj1, d2nvqk1, d2nvql1
    automatically matched to d1a1d__
    complexed with dut, mg, zn

Details for d2nvqh1

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOP Domain Sequences for d2nvqh1:

Sequence, based on SEQRES records: (download)

>d2nvqh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d2nvqh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOP Domain Coordinates for d2nvqh1:

Click to download the PDB-style file with coordinates for d2nvqh1.
(The format of our PDB-style files is described here.)

Timeline for d2nvqh1: