Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) |
Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries) Uniprot P20434; part of multichain biological unit |
Domain d2nvqe1: 2nvq E:2-143 [138638] Other proteins in same PDB: d2nvqa1, d2nvqb1, d2nvqc1, d2nvqc2, d2nvqe2, d2nvqf1, d2nvqh1, d2nvqi1, d2nvqi2, d2nvqj1, d2nvqk1, d2nvql1 automatically matched to d1i3qe1 complexed with dut, mg, zn |
PDB Entry: 2nvq (more details), 2.9 Å
SCOP Domain Sequences for d2nvqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvqe1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam klvpsippatietfneaalvvn
Timeline for d2nvqe1: