SCOPe 2.02: Domain d2nvqc1: 2nvq C:3-37,C:173-268

Lineage for d2nvqc1 (2nvq C:3-37,C:173-268)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d2nvqc1: 2nvq C:3-37,C:173-268 [138636]
   Other proteins in same PDB: d2nvqa1, d2nvqb_, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf1, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql1
   automatically matched to d1i3qc1
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqc1

PDB Entry: 2nvq, 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2nvqc1:

Sequence; same for both SEQRES and ATOM records:

>d2nvqc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

Timeline for d2nvqc1:

• d2nvqc1 first appeared in SCOP 1.73
  
• d2nvqc1 appears in SCOPe 2.01
  
• d2nvqc1 appears in SCOPe 2.03
  
• d2nvqc1 appears in the current release, SCOPe 2.08