Lineage for d2nvna1 (2nvn A:1-121)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856230Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 856231Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (4 families) (S)
  5. 856254Family d.18.1.3: PMN2A0962/syc2379c-like [143038] (2 proteins)
    Pfam PF08848; DUF1818; specific to cyanobacteria; single-chain domain made of two repeats of this structural motif
  6. 856261Protein Hypothetical protein syc2379_c [143041] (1 species)
  7. 856262Species Synechococcus sp. pcc 7942 [TaxId:1140] [143042] (1 PDB entry)
    Uniprot Q5MZF1 1-121
  8. 856263Domain d2nvna1: 2nvn A:1-121 [138633]
    complexed with gol

Details for d2nvna1

PDB Entry: 2nvn (more details), 2.5 Å

PDB Description: crystal structure of a protein with a cupin-like fold and unknown function (yp_400729.1) from synechococcus sp. pcc 7942 (elongatus) at 2.50 a resolution
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2nvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvna1 d.18.1.3 (A:1-121) Hypothetical protein syc2379_c {Synechococcus sp. pcc 7942 [TaxId: 1140]}
mgrilregagwrlgwdetahrypglvgttdwaveltaaemadfcrlvqqlaetiaaiape
lmpeerlqieaesallwleaegfadayelrlilasdrrveacwpaaavpalvaathtlkg
f

SCOP Domain Coordinates for d2nvna1:

Click to download the PDB-style file with coordinates for d2nvna1.
(The format of our PDB-style files is described here.)

Timeline for d2nvna1: