Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily) helix-swapped dimer of beta(4)-alpha motifs |
Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (4 families) |
Family d.18.1.3: PMN2A0962/syc2379c-like [143038] (2 proteins) Pfam PF08848; DUF1818; specific to cyanobacteria; single-chain domain made of two repeats of this structural motif |
Protein Hypothetical protein syc2379_c [143041] (1 species) |
Species Synechococcus sp. pcc 7942 [TaxId:1140] [143042] (1 PDB entry) Uniprot Q5MZF1 1-121 |
Domain d2nvna1: 2nvn A:1-121 [138633] complexed with gol |
PDB Entry: 2nvn (more details), 2.5 Å
SCOP Domain Sequences for d2nvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvna1 d.18.1.3 (A:1-121) Hypothetical protein syc2379_c {Synechococcus sp. pcc 7942 [TaxId: 1140]} mgrilregagwrlgwdetahrypglvgttdwaveltaaemadfcrlvqqlaetiaaiape lmpeerlqieaesallwleaegfadayelrlilasdrrveacwpaaavpalvaathtlkg f
Timeline for d2nvna1: