Lineage for d2nvmb_ (2nvm B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616841Fold d.326: XisI-like [143846] (1 superfamily)
    alpha-beta(4)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order 1234, meander; the open side of beta-sheet provides dimerization interface
  4. 2616842Superfamily d.326.1: XisI-like [143847] (2 families) (S)
  5. 2616843Family d.326.1.1: XisI-like [143848] (3 proteins)
    Pfam PF08869
  6. 2616851Protein XisI [143851] (1 species)
    the fdxN element excision controlling factor
  7. 2616852Species Anabaena variabilis [TaxId:1172] [143852] (1 PDB entry)
    Uniprot Q3MD55 2-118
    Ava1458
  8. 2616854Domain d2nvmb_: 2nvm B: [138632]
    automated match to d2nvma1

Details for d2nvmb_

PDB Entry: 2nvm (more details), 2.19 Å

PDB Description: crystal structure of fdxn element excision controlling factor xisi (yp_321976.1) from anabaena variabilis atcc 29413 at 2.19 a resolution
PDB Compounds: (B:) FdxN element excision controlling factor XisI

SCOPe Domain Sequences for d2nvmb_:

Sequence, based on SEQRES records: (download)

>d2nvmb_ d.326.1.1 (B:) XisI {Anabaena variabilis [TaxId: 1172]}
dklthyrhtiqeiikkyydlsnsqpatatetkisddlpdtvgdrliideqrdqylwlccg
wdgkkrvqhiilylqiqngkiwieedstnlaivdemlvagipqtdiilgfhhpskrglte
faia

Sequence, based on observed residues (ATOM records): (download)

>d2nvmb_ d.326.1.1 (B:) XisI {Anabaena variabilis [TaxId: 1172]}
dklthyrhtiqeiikkyydlsnslpdtvgdrliideqrdqylwlccgwdgkkrvqhiily
lqiqngkiwieedstnlaivdemlvagipqtdiilgfhhpskrgltefaia

SCOPe Domain Coordinates for d2nvmb_:

Click to download the PDB-style file with coordinates for d2nvmb_.
(The format of our PDB-style files is described here.)

Timeline for d2nvmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nvma1