![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.326: XisI-like [143846] (1 superfamily) alpha-beta(4)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order 1234, meander; the open side of beta-sheet provides dimerization interface |
![]() | Superfamily d.326.1: XisI-like [143847] (1 family) ![]() |
![]() | Family d.326.1.1: XisI-like [143848] (3 proteins) Pfam PF08869 |
![]() | Protein XisI [143851] (1 species) the fdxN element excision controlling factor |
![]() | Species Anabaena variabilis [TaxId:1172] [143852] (1 PDB entry) Ava1458 |
![]() | Domain d2nvmb1: 2nvm B:2-118 [138632] automatically matched to 2NVM A:2-118 |
PDB Entry: 2nvm (more details), 2.19 Å
SCOP Domain Sequences for d2nvmb1:
Sequence, based on SEQRES records: (download)
>d2nvmb1 d.326.1.1 (B:2-118) XisI {Anabaena variabilis [TaxId: 1172]} dklthyrhtiqeiikkyydlsnsqpatatetkisddlpdtvgdrliideqrdqylwlccg wdgkkrvqhiilylqiqngkiwieedstnlaivdemlvagipqtdiilgfhhpskrg
>d2nvmb1 d.326.1.1 (B:2-118) XisI {Anabaena variabilis [TaxId: 1172]} dklthyrhtiqeiikkyydlsnslpdtvgdrliideqrdqylwlccgwdgkkrvqhiily lqiqngkiwieedstnlaivdemlvagipqtdiilgfhhpskrg
Timeline for d2nvmb1: