Lineage for d2nvha1 (2nvh A:1-152)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669060Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 669061Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 669200Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)
  6. 669217Protein Interleukin-1beta [50363] (2 species)
  7. 669218Species Human (Homo sapiens) [TaxId:9606] [50364] (20 PDB entries)
  8. 669220Domain d2nvha1: 2nvh A:1-152 [138630]
    automatically matched to d1iob__
    complexed with so4

Details for d2nvha1

PDB Entry: 2nvh (more details), 1.53 Å

PDB Description: determination of solvent content in cavities in interleukin-1 using experimentally-phased electron density
PDB Compounds: (A:) interleukin-1 beta

SCOP Domain Sequences for d2nvha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvha1 b.42.1.2 (A:1-152) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvs

SCOP Domain Coordinates for d2nvha1:

Click to download the PDB-style file with coordinates for d2nvha1.
(The format of our PDB-style files is described here.)

Timeline for d2nvha1: