![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
![]() | Protein Hypothetical protein YaaE [102250] (4 species) glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis |
![]() | Species Bacillus subtilis [TaxId:1423] [102251] (2 PDB entries) |
![]() | Domain d2nv0a_: 2nv0 A: [138625] automated match to d1r9ga_ |
PDB Entry: 2nv0 (more details), 1.73 Å
SCOPe Domain Sequences for d2nv0a_:
Sequence, based on SEQRES records: (download)
>d2nv0a_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt qlfvemveeykqkal
>d2nv0a_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq fmeplrefaaqgkpmfgtcagliilakeiaphlgllnvvvernsfgrqvdsfeadltikg ldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvtqlfv emveeykqkal
Timeline for d2nv0a_: