SCOPe 2.06: Domain d2nv0a_: 2nv0 A:

Lineage for d2nv0a_ (2nv0 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Hypothetical protein YaaE [102250] (4 species)
   glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis

7. Species Bacillus subtilis [TaxId:1423] [102251] (2 PDB entries)

8. Domain d2nv0a_: 2nv0 A: [138625]
   automated match to d1r9ga_

Details for d2nv0a_

PDB Entry: 2nv0, 1.73 Å

PDB Description: Structure of the glutaminase subunit Pdx2 (YaaE) of PLP synthase from Bacillus subtilis

PDB Compounds: (A:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d2nv0a_:

Sequence, based on SEQRES records:

>d2nv0a_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt
qlfvemveeykqkal

Sequence, based on observed residues (ATOM records):

>d2nv0a_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiaphlgllnvvvernsfgrqvdsfeadltikg
ldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvtqlfv
emveeykqkal

Timeline for d2nv0a_:

• d2nv0a_ first appeared in SCOP 1.73, called d2nv0a1
  
• d2nv0a_ appears in SCOPe 2.05
  
• d2nv0a_ appears in SCOPe 2.07
  
• d2nv0a_ appears in the current release, SCOPe 2.08