Lineage for d2nv0a1 (2nv0 A:1-195)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692818Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 692819Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (11 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 692925Protein Hypothetical protein YaaE [102250] (2 species)
    glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis
  7. 692928Species Bacillus subtilis [TaxId:1423] [102251] (2 PDB entries)
  8. 692929Domain d2nv0a1: 2nv0 A:1-195 [138625]
    automatically matched to d1r9ga_

Details for d2nv0a1

PDB Entry: 2nv0 (more details), 1.73 Å

PDB Description: Structure of the glutaminase subunit Pdx2 (YaaE) of PLP synthase from Bacillus subtilis
PDB Compounds: (A:) Glutamine amidotransferase subunit pdxT

SCOP Domain Sequences for d2nv0a1:

Sequence, based on SEQRES records: (download)

>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt
qlfvemveeykqkal

Sequence, based on observed residues (ATOM records): (download)

>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}
mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
fmeplrefaaqgkpmfgtcagliilakeiaphlgllnvvvernsfgrqvdsfeadltikg
ldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvtqlfv
emveeykqkal

SCOP Domain Coordinates for d2nv0a1:

Click to download the PDB-style file with coordinates for d2nv0a1.
(The format of our PDB-style files is described here.)

Timeline for d2nv0a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nv0b1