Lineage for d2nuul_ (2nuu L:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557429Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2557492Protein PII-homolog GlnK [54917] (2 species)
  7. 2557493Species Escherichia coli [TaxId:562] [54918] (3 PDB entries)
  8. 2557502Domain d2nuul_: 2nuu L: [138622]
    Other proteins in same PDB: d2nuua2, d2nuua3, d2nuub2, d2nuub3, d2nuuc2, d2nuuc3, d2nuud2, d2nuud3, d2nuue2, d2nuue3, d2nuuf2, d2nuuf3
    automated match to d1gnka_
    complexed with adp

Details for d2nuul_

PDB Entry: 2nuu (more details), 2.5 Å

PDB Description: regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
PDB Compounds: (L:) Nitrogen regulatory protein P-II 2

SCOPe Domain Sequences for d2nuul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuul_ d.58.5.1 (L:) PII-homolog GlnK {Escherichia coli [TaxId: 562]}
mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal

SCOPe Domain Coordinates for d2nuul_:

Click to download the PDB-style file with coordinates for d2nuul_.
(The format of our PDB-style files is described here.)

Timeline for d2nuul_: