Lineage for d2nuuk_ (2nuu K:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. Protein PII-homolog GlnK [54917] (2 species)
  7. Species Escherichia coli [TaxId:562] [54918] (3 PDB entries)
  8. Domain d2nuuk_: 2nuu K: [138621]
    Other proteins in same PDB: d2nuua2, d2nuua3, d2nuub2, d2nuub3, d2nuuc2, d2nuuc3, d2nuud2, d2nuud3, d2nuue2, d2nuue3, d2nuuf2, d2nuuf3
    automated match to d1gnka_
    complexed with adp

Details for d2nuuk_

PDB Entry: 2nuu (more details), 2.5 Å

PDB Description: regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
PDB Compounds: (K:) Nitrogen regulatory protein P-II 2

SCOPe Domain Sequences for d2nuuk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuuk_ d.58.5.1 (K:) PII-homolog GlnK {Escherichia coli [TaxId: 562]}
mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal

SCOPe Domain Coordinates for d2nuuk_ are not available.

Timeline for d2nuuk_:

Domains from other chains:
(mouse over for more information)
d2nuua2, d2nuua3, d2nuub2, d2nuub3, d2nuuc2, d2nuuc3, d2nuud2, d2nuud3, d2nuue2, d2nuue3, d2nuuf2, d2nuuf3, d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuul_