![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein PII-homolog GlnK [54917] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54918] (3 PDB entries) |
![]() | Domain d2nuuj_: 2nuu J: [138620] Other proteins in same PDB: d2nuua2, d2nuua3, d2nuub2, d2nuub3, d2nuuc2, d2nuuc3, d2nuud2, d2nuud3, d2nuue2, d2nuue3, d2nuuf2, d2nuuf3 automated match to d1gnka_ complexed with adp |
PDB Entry: 2nuu (more details), 2.5 Å
SCOPe Domain Sequences for d2nuuj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuuj_ d.58.5.1 (J:) PII-homolog GlnK {Escherichia coli [TaxId: 562]} mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal
Timeline for d2nuuj_: