![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.44: Ammonium transporter [111351] (1 superfamily) 11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix |
![]() | Superfamily f.44.1: Ammonium transporter [111352] (2 families) ![]() automatically mapped to Pfam PF00909 |
![]() | Family f.44.1.0: automated matches [227165] (1 protein) not a true family |
![]() | Protein automated matches [226873] (5 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [255505] (14 PDB entries) |
![]() | Domain d2nuue2: 2nuu E:3-406 [138615] Other proteins in same PDB: d2nuua3, d2nuub3, d2nuuc3, d2nuud3, d2nuue3, d2nuuf3, d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuuk_, d2nuul_ automated match to d2b2ha_ complexed with adp |
PDB Entry: 2nuu (more details), 2.5 Å
SCOPe Domain Sequences for d2nuue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuue2 f.44.1.0 (E:3-406) automated matches {Escherichia coli [TaxId: 562]} avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait ivwsgvvafigykladltvglrvpeeqeregldvnshgenayna
Timeline for d2nuue2: