Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.44: Ammonium transporter [111351] (1 superfamily) 11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix |
Superfamily f.44.1: Ammonium transporter [111352] (1 family) |
Family f.44.1.1: Ammonium transporter [111353] (1 protein) Pfam PF00909 |
Protein Ammonium transporter AmtB [111354] (1 species) |
Species Escherichia coli [TaxId:562] [111355] (9 PDB entries) |
Domain d2nuua1: 2nuu A:3-386 [138611] Other proteins in same PDB: d2nuug1, d2nuuh1, d2nuui1, d2nuuj1, d2nuuk1, d2nuul1 automatically matched to d1xqea_ complexed with adp |
PDB Entry: 2nuu (more details), 2.5 Å
SCOP Domain Sequences for d2nuua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuua1 f.44.1.1 (A:3-386) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]} avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait ivwsgvvafigykladltvglrvp
Timeline for d2nuua1: