Lineage for d2nuua1 (2nuu A:3-386)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746637Fold f.44: Ammonium transporter [111351] (1 superfamily)
    11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix
  4. 746638Superfamily f.44.1: Ammonium transporter [111352] (1 family) (S)
  5. 746639Family f.44.1.1: Ammonium transporter [111353] (1 protein)
    Pfam PF00909
  6. 746640Protein Ammonium transporter AmtB [111354] (1 species)
  7. 746641Species Escherichia coli [TaxId:562] [111355] (9 PDB entries)
  8. 746650Domain d2nuua1: 2nuu A:3-386 [138611]
    Other proteins in same PDB: d2nuug1, d2nuuh1, d2nuui1, d2nuuj1, d2nuuk1, d2nuul1
    automatically matched to d1xqea_
    complexed with adp

Details for d2nuua1

PDB Entry: 2nuu (more details), 2.5 Å

PDB Description: regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
PDB Compounds: (A:) Ammonia channel

SCOP Domain Sequences for d2nuua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuua1 f.44.1.1 (A:3-386) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
ivwsgvvafigykladltvglrvp

SCOP Domain Coordinates for d2nuua1:

Click to download the PDB-style file with coordinates for d2nuua1.
(The format of our PDB-style files is described here.)

Timeline for d2nuua1: