Lineage for d2nuna_ (2nun A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250253Fold e.45: Antivirulence factor [103382] (1 superfamily)
    contains a helical bundle with a buried helix and an alpha+beta insert domain
  4. 2250254Superfamily e.45.1: Antivirulence factor [103383] (1 family) (S)
    automatically mapped to Pfam PF05394
  5. 2250255Family e.45.1.1: Antivirulence factor [103384] (1 protein)
  6. 2250256Protein Type III effector AvrB [103385] (1 species)
  7. 2250257Species Pseudomonas syringae [TaxId:317] [103386] (3 PDB entries)
  8. 2250261Domain d2nuna_: 2nun A: [138610]
    automated match to d1nh1a_
    complexed with adp, trs

Details for d2nuna_

PDB Entry: 2nun (more details), 2.4 Å

PDB Description: The structure of the type III effector AvrB complexed with ADP
PDB Compounds: (A:) Avirulence B protein

SCOPe Domain Sequences for d2nuna_:

Sequence, based on SEQRES records: (download)

>d2nuna_ e.45.1.1 (A:) Type III effector AvrB {Pseudomonas syringae [TaxId: 317]}
tsfneasrtsfralpgpsqrqlevydqcligaarwpddssksntpenraycqsmynsirs
agdeisrggitsfeelwgratewrlsklqrgeplysafasertsdtdavtplvkpyksvl
arvvdhedahdeimqdnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlr
telgakalkqhlqrynpdridhtnasylpiikdhlndlyrqaissdlsqaelisliarth
wwaasampdqrgsaakaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrsl
ldsd

Sequence, based on observed residues (ATOM records): (download)

>d2nuna_ e.45.1.1 (A:) Type III effector AvrB {Pseudomonas syringae [TaxId: 317]}
tsfneasrtsfralpgpsqrqlevydqcligaarwpddsntpenraycqsmynsirsagd
eisrggitsfeelwgratewrlsklqrgeplysafasertsdtdavtplvkpyksvlarv
vdhedahdeimqdnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlrtel
gakalkqhlqrynpdridhtnasylpiikdhlndlyrqaissdlsqaelisliarthwwa
asampdqrgsaakaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrsllds
d

SCOPe Domain Coordinates for d2nuna_:

Click to download the PDB-style file with coordinates for d2nuna_.
(The format of our PDB-style files is described here.)

Timeline for d2nuna_: