Lineage for d2nuna1 (2nun A:28-317)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 744335Fold e.45: Antivirulence factor [103382] (1 superfamily)
    contains a helical bundle with a buried helix and an alpha+beta insert domain
  4. 744336Superfamily e.45.1: Antivirulence factor [103383] (1 family) (S)
  5. 744337Family e.45.1.1: Antivirulence factor [103384] (1 protein)
  6. 744338Protein Type III effector AvrB [103385] (1 species)
  7. 744339Species Pseudomonas syringae [TaxId:317] [103386] (3 PDB entries)
  8. 744343Domain d2nuna1: 2nun A:28-317 [138610]
    automatically matched to d1nh1a_
    complexed with adp, trs

Details for d2nuna1

PDB Entry: 2nun (more details), 2.4 Å

PDB Description: The structure of the type III effector AvrB complexed with ADP
PDB Compounds: (A:) Avirulence B protein

SCOP Domain Sequences for d2nuna1:

Sequence, based on SEQRES records: (download)

>d2nuna1 e.45.1.1 (A:28-317) Type III effector AvrB {Pseudomonas syringae [TaxId: 317]}
alpgpsqrqlevydqcligaarwpddssksntpenraycqsmynsirsagdeisrggits
feelwgratewrlsklqrgeplysafasertsdtdavtplvkpyksvlarvvdhedahde
imqdnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlrtelgakalkqhl
qrynpdridhtnasylpiikdhlndlyrqaissdlsqaelisliarthwwaasampdqrg
saakaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrslld

Sequence, based on observed residues (ATOM records): (download)

>d2nuna1 e.45.1.1 (A:28-317) Type III effector AvrB {Pseudomonas syringae [TaxId: 317]}
alpgpsqrqlevydqcligaarwpddsntpenraycqsmynsirsagdeisrggitsfee
lwgratewrlsklqrgeplysafasertsdtdavtplvkpyksvlarvvdhedahdeimq
dnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlrtelgakalkqhlqry
npdridhtnasylpiikdhlndlyrqaissdlsqaelisliarthwwaasampdqrgsaa
kaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrslld

SCOP Domain Coordinates for d2nuna1:

Click to download the PDB-style file with coordinates for d2nuna1.
(The format of our PDB-style files is described here.)

Timeline for d2nuna1: