SCOPe 2.05: Domain d2nujb1: 2nuj B:3-161

Lineage for d2nujb1 (2nuj B:3-161)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical protein Jann_1972 [143154] (1 species)

7. Species Jannaschia sp. CCS1 [TaxId:290400] [143155] (1 PDB entry)
   Uniprot Q28QX3 3-161

8. Domain d2nujb1: 2nuj B:3-161 [138609]
   automatically matched to 2NUJ A:3-161
   complexed with mpd

Details for d2nujb1

PDB Entry: 2nuj, 2 Å

PDB Description: crystal structure of thioesterase superfamily (yp_509914.1) from jannaschia sp. ccs1 at 2.00 a resolution

PDB Compounds: (B:) Thioesterase superfamily

SCOPe Domain Sequences for d2nujb1:

Sequence; same for both SEQRES and ATOM records:

>d2nujb1 d.38.1.1 (B:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]}
lppyhtplpaetlralsipapwtfgladrvrfgeldaighvnhtaylrwyesfrlpflka
rhvtdygptsprlvlkqvhctylaemgmgedyvitgrvsnfrttsftmefacwrlgdave
ctsegsavvvllnrdgsgrypipeagrasfvtedgvlaa

Timeline for d2nujb1:

• d2nujb1 first appeared in SCOP 1.73
  
• d2nujb1 appears in SCOPe 2.04
  
• d2nujb1 appears in SCOPe 2.06
  
• d2nujb1 appears in the current release, SCOPe 2.08