![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein Hypothetical protein Jann_1972 [143154] (1 species) |
![]() | Species Jannaschia sp. CCS1 [TaxId:290400] [143155] (1 PDB entry) Uniprot Q28QX3 3-161 |
![]() | Domain d2nujb1: 2nuj B:3-161 [138609] automatically matched to 2NUJ A:3-161 complexed with mpd |
PDB Entry: 2nuj (more details), 2 Å
SCOPe Domain Sequences for d2nujb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nujb1 d.38.1.1 (B:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} lppyhtplpaetlralsipapwtfgladrvrfgeldaighvnhtaylrwyesfrlpflka rhvtdygptsprlvlkqvhctylaemgmgedyvitgrvsnfrttsftmefacwrlgdave ctsegsavvvllnrdgsgrypipeagrasfvtedgvlaa
Timeline for d2nujb1: