Lineage for d2nuja1 (2nuj A:3-161)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943571Protein Hypothetical protein Jann_1972 [143154] (1 species)
  7. 2943572Species Jannaschia sp. CCS1 [TaxId:290400] [143155] (1 PDB entry)
    Uniprot Q28QX3 3-161
  8. 2943573Domain d2nuja1: 2nuj A:3-161 [138608]
    complexed with mpd

Details for d2nuja1

PDB Entry: 2nuj (more details), 2 Å

PDB Description: crystal structure of thioesterase superfamily (yp_509914.1) from jannaschia sp. ccs1 at 2.00 a resolution
PDB Compounds: (A:) Thioesterase superfamily

SCOPe Domain Sequences for d2nuja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]}
lppyhtplpaetlralsipapwtfgladrvrfgeldaighvnhtaylrwyesfrlpflka
rhvtdygptsprlvlkqvhctylaemgmgedyvitgrvsnfrttsftmefacwrlgdave
ctsegsavvvllnrdgsgrypipeagrasfvtedgvlaa

SCOPe Domain Coordinates for d2nuja1:

Click to download the PDB-style file with coordinates for d2nuja1.
(The format of our PDB-style files is described here.)

Timeline for d2nuja1: