Lineage for d2nuba2 (2nub A:315-706)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860115Family c.55.3.10: PIWI domain [110640] (4 proteins)
    Pfam PF02171
  6. 1860116Protein Argonaute homologue Aq_1447 [142501] (1 species)
    includes the middle domain
  7. 1860117Species Aquifex aeolicus [TaxId:63363] [142502] (2 PDB entries)
    Uniprot O67434 315-706
  8. 1860119Domain d2nuba2: 2nub A:315-706 [138605]
    Other proteins in same PDB: d2nuba1
    automatically matched to 1YVU A:315-706

Details for d2nuba2

PDB Entry: 2nub (more details), 3.2 Å

PDB Description: Structure of Aquifex aeolicus Argonuate
PDB Compounds: (A:) Argonaute

SCOPe Domain Sequences for d2nuba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuba2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk
elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk
sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegk
vdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgekltekaigdvfsl
leklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfik
gyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpik
lpatvhysdkitklmlrgiepikkegdimywl

SCOPe Domain Coordinates for d2nuba2:

Click to download the PDB-style file with coordinates for d2nuba2.
(The format of our PDB-style files is described here.)

Timeline for d2nuba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nuba1