SCOPe 2.03: Domain d2nuba2: 2nub A:315-706

Lineage for d2nuba2 (2nub A:315-706)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.10: PIWI domain [110640] (3 proteins)
   Pfam PF02171

6. Protein Argonaute homologue Aq_1447 [142501] (1 species)
   includes the middle domain

7. Species Aquifex aeolicus [TaxId:63363] [142502] (4 PDB entries)
   Uniprot O67434 315-706

8. Domain d2nuba2: 2nub A:315-706 [138605]
   Other proteins in same PDB: d2nuba1
   automatically matched to 1YVU A:315-706

Details for d2nuba2

PDB Entry: 2nub, 3.2 Å

PDB Description: Structure of Aquifex aeolicus Argonuate

PDB Compounds: (A:) Argonaute

SCOPe Domain Sequences for d2nuba2:

Sequence; same for both SEQRES and ATOM records:

>d2nuba2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk
elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk
sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegk
vdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgekltekaigdvfsl
leklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfik
gyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpik
lpatvhysdkitklmlrgiepikkegdimywl

Timeline for d2nuba2:

• d2nuba2 first appeared in SCOP 1.73
  
• d2nuba2 appears in SCOPe 2.02
  
• d2nuba2 appears in SCOPe 2.04
  
• d2nuba2 last appears in SCOPe 2.05