Lineage for d2nuba2 (2nub A:315-706)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837319Family c.55.3.10: PIWI domain [110640] (3 proteins)
    Pfam PF02171
  6. 837320Protein Argonaute homologue Aq_1447 [142501] (1 species)
    includes the middle domain
  7. 837321Species Aquifex aeolicus [TaxId:63363] [142502] (4 PDB entries)
    Uniprot O67434 315-706
  8. 837327Domain d2nuba2: 2nub A:315-706 [138605]
    Other proteins in same PDB: d2nuba1
    automatically matched to 1YVU A:315-706

Details for d2nuba2

PDB Entry: 2nub (more details), 3.2 Å

PDB Description: Structure of Aquifex aeolicus Argonuate
PDB Compounds: (A:) Argonaute

SCOP Domain Sequences for d2nuba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuba2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk
elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk
sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegk
vdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgekltekaigdvfsl
leklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfik
gyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpik
lpatvhysdkitklmlrgiepikkegdimywl

SCOP Domain Coordinates for d2nuba2:

Click to download the PDB-style file with coordinates for d2nuba2.
(The format of our PDB-style files is described here.)

Timeline for d2nuba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nuba1